NPS@ is the IBCP contribution to PBIL in Lyon, France
[HOME] [NPS@] [SRS] [HELP] [REFERENCES] [NEWS] [MPSA] [ANTHEPROT] [Geno3D] [PBIL]
Tuesday, July 17th 2001 : A link between NPS@ and Geno3D is available (see news)
Job PREDATOR (ID: 720114) is running on NPS@ server (started on Tue Nov 13 07:06:49 CET 2001).
Results will be shown below. Please wait and don't go back.

PREDATOR result for : UNK_7201140

Abstract Frishman D., Argos P., Incorporation of non-local interactions in protein secondary structure prediction from the amino acid sequence. Protein Eng 1996 Feb;9(2):133-142

View PREDATOR in: [MPSA (Mac, UNIX) , About...] [AnTheProt (PC) , Download...] [HELP] 

        10        20        30        40        50        60        70
         |         |         |         |         |         |         |
MLAQTFKKPHRAVLEQVSGTTVFIRNKRTKSKSSLSPLAQRVVTQLSVMSASRKQPKLLKLAREDLIKHQ
ccccccchhhhhhcccccceeeeeeeccccccccchhhhhhhhhhhccccccccchhhhhhhhhhhhhcc
TIEKCWSIYQQQQRERRNLQLELQYKSIERSMNLLQELSPRLFEAANASEKGKRFPMEMKVPTDFPPNTL
ccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhchhhhhhhhcccccccccccccccccccccccc
WHYNFRK
ccccccc

Sequence length :   147

PREDATOR :
   Alpha helix     (Hh) :    70 is  47.62%
   310  helix       (Gg) :     0 is   0.00%
   Pi helix        (Ii) :     0 is   0.00%
   Beta bridge     (Bb) :     0 is   0.00%
   Extended strand (Ee) :     7 is   4.76%
   Beta turn       (Tt) :     0 is   0.00%
   Bend region     (Ss) :     0 is   0.00%
   Random coil     (Cc) :    70 is  47.62%
   Ambigous states (?)  :     0 is   0.00%
   Other states         :     0 is   0.00%


Parameters :
   Secondary structure data width         : dssp

Prediction result file (text): [PREDATOR]

User : public@65.80.142.166. Last modification time : Tue Nov 13 07:06:52 2001. Current time : Tue Nov 13 07:06:52 2001 This service is supported by Ministere de la recherche (ACC-SV13), CNRS (IMABIO, COMI, GENOME) and Région Rhône-Alpes (Programme EMERGENCE) . Comments.