E. Coli Era- Ras Homolog
LOCUS AE000343
906 bp DNA
BCT 12-NOV-1998
DEFINITION CDS from: Escherichia coli K-12 MG1655 section 233
of 400 of the
complete genome.
ACCESSION AE000343
VERSION AE000343.1
KEYWORDS .
SOURCE Escherichia coli.
ORGANISM Escherichia coli
Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
Escherichia.
REFERENCE 1 (bases 2241 to 3146)
AUTHORS Blattner,F.R., Plunkett,G. III, Bloch,C.A.,
Perna,N.T., Burland,V.,
Riley,M., Collado-Vides,J., Glasner,J.D., Rode,C.K., Mayhew,G.F.,
Gregor,J., Davis,N.W., Kirkpatrick,H.A., Goeden,M.A., Rose,D.J.,
Mau,B. and Shao,Y.
TITLE The complete genome sequence of
Escherichia coli K-12
JOURNAL Science 277 (5331), 1453-1474 (1997)
MEDLINE 97426617
REFERENCE 2 (bases 2241 to 3146)
AUTHORS Blattner,F.R.
TITLE Direct Submission
JOURNAL Submitted (16-JAN-1997) Guy Plunkett III,
Laboratory of Genetics,
University of Wisconsin, 445 Henry Mall, Madison, WI 53706, USA.
Email: ecoli@genetics.wisc.edu Phone: 608-262-2534 Fax:
608-263-7459
REFERENCE 3 (bases 2241 to 3146)
AUTHORS Blattner,F.R.
TITLE Direct Submission
JOURNAL Submitted (02-SEP-1997) Guy Plunkett III,
Laboratory of Genetics,
University of Wisconsin, 445 Henry Mall, Madison, WI 53706, USA.
Email: ecoli@genetics.wisc.edu Phone: 608-262-2534 Fax:
608-263-7459
REFERENCE 4 (bases 2241 to 3146)
AUTHORS Plunkett,G. III.
TITLE Direct Submission
JOURNAL Submitted (13-OCT-1998) Laboratory of Genetics,
University of
Wisconsin, 445 Henry Mall, Madison, WI 53706, USA
COMMENT On Sep 9, 1997 this sequence version
replaced gi:1788915.
This sequence was determined by the E. coli Genome Project at the
University of Wisconsin-Madison (Frederick R. Blattner, director).
Supported by NIH grants HG00301 and HG01428 (from the Human Genome
Project and NCHGR). The entire sequence was independently
determined from E. coli K-12 strain MG1655. Predicted open reading
frames were determined using GeneMark software, kindly supplied by
Mark Borodovsky, Georgia Institute of Technology, Atlanta, GA,
30332 [e-mail: mark@amber.gatech.edu]. Open reading frames that
have been correlated with genetic loci are being annotated with CG
Site Nos., unique ID nos. for the genes in the E. coli Genetic
Stock Center (CGSC) database at Yale University, kindly supplied by
Mary Berlyn. A public version of the database is accessible
(http://cgsc.biology.yale.edu). Annotation of the genome is an
ongoing task whose goal is to make the genome sequence more useful
by correlating it with other data. Comments to the authors are
appreciated. Updated information will be available at the E. coli
Genome Project's World Wide Web site
(http://www.genetics.wisc.edu). *** The E. coli K-12 sequence and
its annotations are periodically updated; this is version M54. No
sequence changes. Annotation updates: updated gene identifications
and products; all new functional assignments courtesy of Monica
Riley; added promoters, protein binding sites, and repeated
sequences described in reference 1. The unique numeric identifiers
beginning with a lowercase 'b' assigned to each gene (protein- or
RNA-encoding) are now designated as gene synonyms instead of
labels. This should allow them to be searched for in Entrez as gene
names.
FEATURES
Location/Qualifiers
gene
1..906
/gene="era"
/note="b2566"
CDS
1..906
/gene="era"
/function="factor; Global regulatory functions"
/note="f301; 100 pct identical to ERA_ECOLI SW: P06616; CG
Site No. 29010"
/codon_start=1
/transl_table=11
/product="GTP-binding protein"
/protein_id="AAC75619.1"
/db_xref="PID:g1788919"
/db_xref="GI:1788919"
/translation="MSIDKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTR
HRIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWT
PDDEMVLNKLREGKAPVILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGL
NVDTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEI
ERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLE
LWVKVKSGWADDERALRSLGYVDDL"
promoter
818..847
/gene="era"
/note="factor Sigma70; predicted +1 start at 2700553"
protein_bind 824..844
/gene="era"
/note="central position to predicted promoter:86.5"
/bound_moiety="DnaA predicted site"
protein_bind 824..844
/gene="era"
/note="central position to predicted promoter:22.5"
/bound_moiety="DnaA predicted site"
protein_bind 824..844
/gene="era"
/note="central position to predicted promoter: -0.5"
/bound_moiety="DnaA predicted site"
promoter
796..824
/gene="era"
/note="factor Sigma70; predicted +1 start at 2700576"
promoter
733..760
/gene="era"
/note="factor Sigma70; predicted +1 start at 2700640"
BASE COUNT 238 a 229
c 245 g 194 t
ORIGIN
1 atgagcatcg ataaaagtta
ctgcggattt attgccatcg tcggacgtcc gaacgttggc
61 aaatccacat tgttgaacaa actgctgggg
cagaaaatct ccatcacttc ccgcaaggcg
121 cagacaactc gtcaccgcat tgtggggatc
catactgaag gcgcgtatca ggcgatctac
181 gtcgatacac cgggcctgca tatggaagaa
aaacgcgcca ttaaccgcct gatgaacaaa
241 gcggcgagca gctctattgg cgatgttgag
ctggtgattt ttgtcgttga aggcacccgc
301 tggacgccgg acgacgaaat ggtgctcaac
aaactgcgcg aaggcaaagc gccggtaatc
361 ctcgcggtga acaaagtgga caacgtgcag
gagaaagccg atctgctgcc gcacctgcag
421 ttcctggcaa gccagatgaa cttcctcgat
atcgtgccaa tctctgccga aaccgggctg
481 aatgttgaca ctattgcggc aatcgtgcgt
aagcatctac ctgaagcgac tcatcacttc
541 ccggaagatt acatcaccga tcgctcacag
cgttttatgg cgtctgaaat catccgcgaa
601 aaactgatgc gtttcctcgg cgctgaactg
ccgtactccg tgaccgtgga gatcgaacgt
661 ttcgtctcta acgaacgcgg tggttatgac
atcaacggtt tgattctcgt tgagcgtgaa
721 gggcagaaga agatggtcat tggcaacaaa
ggggccaaga tcaaaaccat cgggattgaa
781 gcgcgtaaag acatgcagga aatgttcgaa
gcgcctgttc accttgaact gtgggtaaaa
841 gtgaaatccg gttgggccga cgacgaacgc
gcactgcgca gtctcggtta cgttgacgat
901 ctttaa
[Home] [Davidson Molecular Biology web page]
Email any questions, comments or suggestions to: macampbell@davidson.edu