LOCUS       SUSHISES2     662 bp    DNA             INV       18-MAR-1994
DEFINITION  Sea urchin (S.purpuratus) early histone ( EH4 ) gene, complete cds.
ACCESSION   J01172 J01204 V01355
NID         g161502
KEYWORDS    histone; histone H4.
            2 of 4
SOURCE      Strongylocentrotus purpuratus DNA.
  ORGANISM  Strongylocentrotus purpuratus
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Echinodermata;
            Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida;
            Strongylocentrotidae; Strongylocentrotus.
REFERENCE   1  (bases 1 to 498)
  AUTHORS   Grunstein,M. and Grunstein,J.E.
  TITLE     The histone H4 gene of Strongylocentrotus purpuratus: DNA and mRNA
            sequences at the 5' end
  JOURNAL   Cold Spring Harb. Symp. Quant. Biol. 42, 1083-1092 (1978)
  MEDLINE   78237814
REFERENCE   2  (bases 1 to 662)
  AUTHORS   Grunstein,M., Diamond,K.E., Knoppel,E. and Grunstein,J.E.
  TITLE     Comparison of the early histone H4 gene sequence of
            Strongylocentrotus purpuratus with maternal, early, and late
            histone H4 mRNA sequences
  JOURNAL   Biochemistry 20, 1216-1223 (1981)
  MEDLINE   81184387
COMMENT     All four entries beginning <surhises> are from a pair of clones sp2
            and sp17 which cover the early histone gene repeat. This unit is
            about 6.5kb long, contains the H1, H4, H2B, H3 and H2A genes in
            that order, and is repeated several hundred times. The five coding
            regions are separated by DNA spacers not represented in polysomal
            mRNA; there are no reported introns. Discrepancies in H4 sequences
            are resolved in the later ref, [2]. [2] argues that maternal
            histones in the egg are early type, and that late histones are
            quite different in sequence.
FEATURES             Location/Qualifiers
     source          1..662
                     /organism="Strongylocentrotus purpuratus"
                     /db_xref="taxon:7668"
     mRNA            165..556
                     /note="h4 mRNA"
     CDS             232..543
                     /codon_start=1
                     /product="histone H4"
                     /db_xref="PID:g161507"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFG
                     G"
BASE COUNT      202 a    156 c    167 g    136 t      1 others
ORIGIN      Hae3 site about 300 bp after segment 1.
        1 acataaatgc atgtactaat gctagcgaat actcgccaca agggggcgca actcgaatgg
       61 ggagtctccg cactccagtc ccgcataccg taacgatgcc gcaatctcgg tcacccaagt
      121 ccgcaatggt gtaacaatac tcggtgcaat ccggttgagg catcattcgc ttagcgtaat
      181 atccagtcta caggatcaca cagaactcgc tctcaactat caatcatcat catgtcaggt
      241 cgaggaaaag gaggaaaggg actcggaaag ggtggtgcca aacgtcatcg caaggttcta
      301 cgagataaca tccaaggcat caccaagcct gcaatccgtc gactngctag aaggggaggt
      361 gtcaagagga tctctggtct catctacgaa gagacacgcg gtgtactgaa ggtcttcctg
      421 gagaatgtca tccgtgatgc agtcacctac tgcgagcacg ctaagcgaaa gactgtcaca
      481 gccatggacg tggtgtatgc actaaagagg cagggtcgta cattgtacgg cttcggcggc
      541 taagtgtagc agacctgcta gaataacaaa cggctctttt cagagccacc aaataatcaa
      601 gaaagaatac tgttgtatgt tatgttacta ccgtaaagaa agtaaagaaa gaagaagaag
      661 aa
//